DPCstruct | MC143
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 78 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 41.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F8VE87 | 1-79 | MIDPKSMNDIVQRLVDALPKGLTNLPKDLEQNFRSVLHSAFNKMDLVTREEFDAQTKVLHRTREKLEQLEKKIQHMEHR |
| A0A5C2HH62 | 2-76 | EQRVEALTSQLLKLLPADVALLKRDLKQQIEGVLQQAFIEMELVTREEFEIQQKVLARSRQKLEQLERRLAELEQ |
| A0A2N1YN99 | 1-79 | None |
| A0A8A6AXN5 | 1-80 | None |
| A0A661FX83 | 27-110 | None |
| A0A1G0IB05 | 1-83 | None |
| K2BA36 | 26-106 | None |
| A0A3D4UAT6 | 4-80 | None |
| A0A1I6HLD0 | 1-77 | None |
| A0A523M9V4 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.