DPCstruct | MC14299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A417WXH8 | 2-75 | IPRKFTGEMLKGRKATLERDIRNVAGVAIGKGATVTITEVVRGKGLTIKTEKCPHCGQYSYITRVQREDLTLLP |
| A0A097J0A3 | 24-106 | MSKRYAVVPHPKLKREYKGRLVRTTRVLKNGWGVIPLGAVATVTHQSPKGSELTFEPCDCCGLKAIISHVSMDSIEFIEPITE |
| B6WRU5 | 11-108 | None |
| A0A3M4BIC9 | 6-78 | None |
| A0A0K2S3B0 | 7-89 | None |
| X1Q3Z6 | 12-84 | None |
| A0A376F354 | 67-146 | None |
| A0A7I0CRW1 | 9-83 | None |
| A0A811XNU6 | 2-82 | None |
| A0A562XI12 | 22-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.