DPCstruct | MC14298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 126 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081D3X1 | 1-137 | MKASLEKYSNLWKLTVYDKSTHGSTPEKGKNALYDLMKMLKVLGINNNLVNFYDKYLVDSLDGKKLGIDHYDEETYNMVCFSGVCKL… |
| A0A077ZPW7 | 451-568 | DALSVTIHGKNISVQGKRAPSNAPELGENAITLLAEKILQEQAVTGTLAEYFSWLIKSLANQHHGEGLGLAFSDADSGKLMITPYEL… |
| T2RGV2 | 3-127 | None |
| A0A4V2NBW6 | 56-192 | None |
| A0A5S9MEX5 | 105-228 | None |
| M7NEK8 | 33-169 | None |
| A0A2N0QJD7 | 2-116 | None |
| A0A5B7THB8 | 2-102 | None |
| A0A1I0H9Q2 | 1-128 | None |
| D1YJP0 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.