DPCstruct | MC14297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8SF58 | 14-72 | LIPVSADAHNCKCRNRGVMFKLGEVSCLNVDGGSYLARCEMKLNVSSWTKVQEGCPVTE |
| A0A848Y825 | 7-79 | ISALLLAACTSTAVAGPNCTCRFQGENFQIGEVACILGQLKQCEMKLNNTSWRTLSEGCPQAQLQRSPPVQST |
| A0A1M2ZPA4 | 1-90 | None |
| A0A2N6AVI6 | 49-135 | None |
| A0A363TWJ5 | 1-75 | None |
| G8PKS8 | 19-89 | None |
| A0A3B0R9C3 | 4-78 | None |
| A0A0P6VYN6 | 25-110 | None |
| A0A4S4AGH3 | 1-83 | None |
| A0A291FPJ3 | 35-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.