DPCstruct | MC14295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1332 |
|---|---|
| Mean domain length (aa) | 215 ± 47 aa |
| Standard deviation of domain lengths | 46.78 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 14.22 |
| Pfam Score | 85.21 |
| Assigned Pfam label(s) | PF01775- PF10288- CL0113- CL0020- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y2FTI0 | 25-246 | FKKMRKRLVRQVRQAIDDFSMLAGMDKRRWLVGLSGGKDSYGLLAILLDLQWRGLLPVELIACNLDQGQPNFPKHVLPEFLTRHGIA… |
| A0A2T1KDB9 | 135-367 | EFVGTLQSELEGYIEGSSTVGILLSGGMDSRVVAGVLRKVQEQNPGGFDVVALTWGAAGSRDVVYAERIAHQFGWALEHFPISVETL… |
| A0A1A9X6P1 | 3-194 | None |
| A0A259MIH9 | 190-415 | None |
| A0A0F9NWI8 | 2-190 | None |
| A0A4Z0Z7D6 | 39-247 | None |
| A0A4Z0YNT3 | 25-267 | None |
| A0A7X9PYX3 | 2-195 | None |
| A0A496T4Q2 | 34-193 | None |
| A0A1I5YH54 | 31-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.