DPCstruct | MC14290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 125 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0F7R3 | 110-242 | MQPVVAGMAIAASRACGVLLAGGTQMLAVYGLIKAWTKQESLDWNPNQIVVGTTRWVADDPTGDTVGLAKTLDAPLLATQLHFHDAR… |
| A0A1V4TQZ3 | 1-112 | MAGGTQMAAVMAIVKGLAPNVLSNIALGTTKWIVNDRTSDVRSIVRQIGNVPILAADLDFGPSQHDGLNVYEKGLVKEGVGAGGISV… |
| A0A2J2H8D2 | 221-324 | None |
| A0A7J4LNN9 | 26-148 | None |
| A0A850MCJ0 | 17-146 | None |
| A0A6N4AQF8 | 1-143 | None |
| A0A7J2SZV3 | 200-328 | None |
| A0A7L4Q5Q6 | 48-176 | None |
| A0A7K3YFC6 | 82-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.