DPCstruct | MC1429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 50.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A640VS94 | 1-59 | MPLTLHPNITDPDGFYQELLDAHEGKTKADSDALNARLILILANHIGDRAVLRDALEAA |
| A0A315CRX6 | 1-57 | MKTELNLQDADTFYEQLLNAHEGLSAEQSEQLNMRLILLLANQVGDAAVLRDCIESA |
| A0A849BFL9 | 18-76 | None |
| A0A433BVU8 | 2-59 | None |
| A0A7C4E5P3 | 3-61 | None |
| A0A0K6H524 | 1-62 | None |
| A0A5C5SW44 | 1-62 | None |
| A0A1Q2YXF6 | 1-62 | None |
| K0DQ38 | 1-74 | None |
| A0A843RFY8 | 33-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.