DPCstruct | MC14287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 176 ± 26 aa |
| Standard deviation of domain lengths | 25.71 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0NDS3 | 55-233 | LRAIPWVFSWTQARCLVPAWFGLGTALTSMVDDPESLERLRTMYREWTFFRVTIDNAELALAKTDLQIAECYANLARDTAELMKIGA… |
| H3RII2 | 34-205 | LRAIPWIFAWTQNRLMLPAWLGAGAALQQAMLAGHQDQLEAMCRDWPFFSTRLGMLEMVFSKADLWLAEYYDQRLVDKSLWPLGKQL… |
| K0TPE1 | 3-166 | None |
| A0A0D3ADJ4 | 444-661 | None |
| A0A6L5DD78 | 12-158 | None |
| A0A6A3ARV7 | 343-515 | None |
| A0A6L2NYT8 | 435-655 | None |
| A0A0K1PFT0 | 861-1026 | None |
| A0A7V9I1A3 | 393-559 | None |
| A0A6T6KDZ4 | 19-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.