DPCstruct | MC14286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 53 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 61.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U5JFU6 | 76-133 | KCSPVYEQDVDSFAEASEPLIKWLAENVHPHHSVIVTATHAELLQGEKVHRTEKFLRD |
| H3REA0 | 1-49 | MDSFAEASEPLIKWLAENVHPHHSVIVTATHAELLQGEKVHRTEKFLRD |
| A0A378GPY3 | 146-201 | None |
| A0A3L1NIG4 | 1-59 | None |
| E3PG26 | 154-201 | None |
| A0A379YAV8 | 123-169 | None |
| A0A3T0QUN0 | 69-124 | None |
| A0A0U1KG04 | 107-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.