DPCstruct | MC14284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 76 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 61.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3RBH3 | 16-84 | ALQVSIPDGWKLVPVEPTEEMVIRGFESAPSVIFSDPADWAAYEAMSGCQQAAHEAKLCYSAMLAAAPE |
| A0A7U5G1P2 | 52-120 | ALQVSIPDGWKLVPVEPTEEMVIRGFESAPSVIFSDPADWAAYEAMSGCQQAAHEAKLCYSAMLAAAPE |
| A0A753AG24 | 68-131 | None |
| A0A7I7A5C5 | 185-256 | None |
| A0A317Q790 | 91-170 | None |
| A0A5A9CRI7 | 195-270 | None |
| J3EVJ5 | 1-65 | None |
| A0A2D9ENR7 | 43-111 | None |
| A0A0J6M726 | 106-190 | None |
| A0A443VMP2 | 111-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.