DPCstruct | MC1428
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 496 ± 105 aa |
| Standard deviation of domain lengths | 105.28 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 16.03 |
| Pfam Score | 47.28 |
| Assigned Pfam label(s) | PF07587- PF07583- PF08811- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A315CQT3 | 41-543 | QVTVVTAKPNNVNAYAAARFLEQASWGPTPASVAEVQRLGIEGWLNQQLGLRASVLNAPNYVIDYDDSNKAAQDLAWQWVDKSLYDV… |
| W7VU63 | 11-422 | AWLAAQMTTASARYTRGGNGDVHQWTGSGNYCDGRSATCWRDNFSSQPLLWDFYRNAVGGADQLRQRVAFALQKIVVVSNLEVEGTY… |
| A0A2G4HEP0 | 702-1223 | None |
| A0A2S8BIB3 | 10-392 | None |
| A0A368B648 | 112-743 | None |
| A0A258TU40 | 768-1141 | None |
| C6C708 | 22-401 | None |
| A0A7C8DNS8 | 652-1193 | None |
| A0A661IAA2 | 587-1192 | None |
| A0A2V5VPZ8 | 314-810 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.