DPCstruct | MC14278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 142 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4YKS0 | 51-180 | VINFCTVFLACLFALVGFAKLSPMLTADLHRVLVEDFKRYTQALHLGQIGMDATAFRVLVGMHEIFLAVGLVTTYALFAAIVLALIM… |
| A0A834RGL2 | 1-142 | MFSFFFGLLKISRSLNYDIHREIRRNFVRYAKVMPFVRYFGWSFSSKYYRLLIGWFEIILGALLAFCPGRTKQIANLLLICITFGAI… |
| A0A5J4NY39 | 20-153 | None |
| A0A448X493 | 7-147 | None |
| A9UV76 | 626-765 | None |
| T1JC91 | 2-146 | None |
| A0A1I8IJ91 | 748-898 | None |
| A0A7N4P1Q5 | 166-306 | None |
| A0A818FU53 | 122-281 | None |
| A0A1J1J460 | 3-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.