DPCstruct | MC14277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 7.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 83.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151R6I0 | 14-88 | TMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLATS |
| A0A7J8TJ27 | 65-134 | TIELVLVKEVRLETLRGLNGLNLCRLKKDIQPWLEQRSAEYMTHASLGSLNSIGGIATEINAINYVYPRS |
| A0A650G361 | 362-428 | None |
| A0A5N6PPM0 | 1-68 | None |
| A0A2G2XC93 | 62-109 | None |
| A0A7J9EA32 | 3-70 | None |
| A0A6N2AEB9 | 14-83 | None |
| A0A7J6ENX8 | 1-84 | None |
| D7MGZ1 | 1-52 | None |
| K0RJ67 | 296-366 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.