DPCstruct | MC14276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 4.21 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 82.30 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF02788- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A251SUD6 | 85-162 | DRYKGRCYGLEPVPGEDNQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPTAYVKTFDGPPHGI |
| A0A7J8TH18 | 40-117 | KCYNGRCYHIEPIPGEEDQYICYEAYCLDLFEECSVTNMFTSIVGNVFGFKALRALRLEDLRILTTYIKTFQGSPHGI |
| A0A822ZW51 | 1-74 | None |
| A0A650CZK2 | 85-162 | None |
| A0A445B7R8 | 78-155 | None |
| A0A7J6ENM6 | 62-139 | None |
| A0A4Y6I4N3 | 85-162 | None |
| B7FI85 | 78-155 | None |
| A0A7J8UH00 | 1-79 | None |
| A0A7J9EY07 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.