DPCstruct | MC14273
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 173 ± 18 aa |
| Standard deviation of domain lengths | 18.36 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.82 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0029- PF15014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9EXL0 | 160-323 | PTRNTFNEMAKWVKRDNETGIYYETWTVQASPARGAETWFESYDCSKFVLRTYKKLAELGAEFKKIETNYTRIFLYSGEPTYLGNET… |
| H2Q7N7 | 236-399 | ISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNET… |
| A0A7J6RXD6 | 2-161 | None |
| A0A1Q9E031 | 138-359 | None |
| A0A1Q9C9U7 | 166-363 | None |
| A0A812LVP8 | 267-450 | None |
| R1BRG1 | 157-359 | None |
| F0ZCV4 | 5-177 | None |
| A0A814EQA4 | 1031-1193 | None |
| R1DHU2 | 156-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.