DPCstruct | MC14272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 213 ± 35 aa |
| Standard deviation of domain lengths | 35.41 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 92.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.81 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0020- PF01545- CL0064- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348MNL5 | 7-230 | LAAIKAKAQNGKDLEMAAYHKIERPYLGTANPDIDFLVKKWRAELTLETRLLLCQGLWDSNIHEGQIAAAKLLTQARIRPDDNGAWA… |
| A0A7C4YU68 | 10-174 | HALALEVWDSGVHEAKIFAGFLDDPKLVTEKQMEKWAIDFDSWDVVDMVCGNLFDRTEFAYKKAVEWSGRKEEFVKRAGFVLMATLS… |
| A0A449BBB0 | 11-234 | None |
| M7AEU6 | 1-160 | None |
| A0A7J9ZJQ1 | 9-174 | None |
| A0A0V0QJI8 | 62-316 | None |
| A0A6J7XP31 | 5-190 | None |
| A0A534N2M1 | 12-238 | None |
| A0A511TE94 | 7-242 | None |
| A0A7S1TDN4 | 3-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.