DPCstruct | MC14271
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 11.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380TNM5 | 1-117 | MRSDIGGYDRPQFDDLTMSLSSLPDLKTESESAVDLPLFLQHKSTNAHYLPNAKVRDYLITCLSDWVRKYGVDGFRVDTAKHVEKST… |
| A0A447PUN4 | 138-246 | RTDIGDYDSPGFDDLTLSLAFLPDIKTESTTPSGLPVFYANKPDTKAKFIEGYTPRDYLTHWLSQWVHDYGIDGFRVDTAKNVELPA… |
| A0A7C7ESR6 | 254-376 | None |
| R6U0W0 | 262-398 | None |
| W4QC41 | 234-361 | None |
| A0A746EP67 | 382-490 | None |
| A0A090T0C8 | 37-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.