DPCstruct | MC1427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 27.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0050 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5FXN9 | 17-115 | ALRARLQSTLSAMPPLRAIGCNVLDATHEHLLLGAPLALNINDKGNAFGGSMASLMTVACWGLFNLHLQRAGIHAEVYVQDSQIRYL… |
| A0A7C7LDL8 | 1-82 | MRDYIQKIIDQEIPIARKMGIKVNSYLPTRIVLDIPLRANRNHRHTAFGGSIYSGLVLAGWCLLIGNLQANNLAGDVVIQRG |
| A0A655X9J1 | 73-170 | None |
| A0A830HBT5 | 102-205 | None |
| A0A1L3L5C2 | 62-156 | None |
| A0A6M1HU67 | 45-125 | None |
| A0A2E1NX28 | 14-127 | None |
| A0A3N5XB39 | 22-118 | None |
| A0A8B1BCI3 | 4-103 | None |
| A0A3T1DLY0 | 2-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.