DPCstruct | MC14268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 249 |
|---|---|
| Mean domain length (aa) | 115 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13399 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8K968 | 23-124 | LTPASEKPMPVERKVVRVEVLNGCGIAGLAKKITDFLRIKGFDVVNVGNAESFEFPETIVVDRVGDMASAWSVARAIGVNNVIQQRD… |
| A0A645FMA5 | 11-106 | KSMPESVAVLNGTGKAGVSSEISTRLQQLGVDVIHSGNAKHFDYQHCNIVYPTNASEKVKTTAQRLGTLLNIPKNLVRPSQQAFYAS… |
| A0A316NZV5 | 264-362 | None |
| A0A7Z0EQE9 | 365-466 | None |
| A0A0D4C0N0 | 28-146 | None |
| A0A2M6YBK5 | 60-160 | None |
| A0A101P2L9 | 336-443 | None |
| A0A2U1ZND1 | 33-157 | None |
| A0A3D3LFA3 | 184-307 | None |
| A0A516X127 | 517-631 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.