DPCstruct | MC14267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 18.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20101 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3XQ94 | 2-97 | IEGRTAGQPLRCLPSHTLDSSTIIDGTAIVYRRGSTLYVNRPRSGAESLDDADVLVTTLYGAQLCQTDKVDLVDRYSRIWNGFVLLG… |
| A0A328T6K9 | 7-113 | RAARAARFEAAAGQPVNHIQLNSIRGFYAWDPINDHQVVAYVTPRRVYLMDLPSCPGLEYTPAISITSHMEQVSATFDSIIPSNTGV… |
| A0A2M9EJE2 | 3-110 | None |
| A0A7Y1TYF9 | 5-138 | None |
| A0A2G2LGJ3 | 8-114 | None |
| A0A838L5I4 | 3-117 | None |
| A0A2D6V8R6 | 9-149 | None |
| G7TA48 | 58-173 | None |
| A0A0Q7EGT7 | 1-145 | None |
| A0A6N9B198 | 68-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.