DPCstruct | MC14263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 249 ± 15 aa |
| Standard deviation of domain lengths | 15.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137- CL0051 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287ETH3 | 1-253 | PQGAGKGQALIYLLEKFNLCGKPPNNVLVCGDSGNDADLFSVPSAYGVMVSNAQEELLEWYEENGKDNLKLLYATERCASGIMQAIG… |
| A0A287ETF9 | 1-242 | MTSSLSFCDQLDVKIIYSSGEALDVLPQGAGKGQALIYLLEKFNLCGKPPNNVLVCGDSGNDADLFSVPSAYGVMVSNAQEELLEWY… |
| A0A1S3E686 | 139-377 | None |
| A0A4Y1S1S5 | 300-542 | None |
| A0A7I4CJL7 | 67-301 | None |
| A0A0D2U244 | 29-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.