DPCstruct | MC14262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 57 ± 6 aa |
| Standard deviation of domain lengths | 5.63 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 74.04 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0016- PF03348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287ESY6 | 15-67 | SSYTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLDIITDLLGTPSPETIARI |
| A0A6N2L7A0 | 179-229 | YTPAIDIWSIGCIFAELLTGKPLFPGKNVVHQLELITDLLGTPSAESIARI |
| A0A482WJS8 | 5-61 | None |
| A0A6A6MFR3 | 450-509 | None |
| A0A453F6Q9 | 1-59 | None |
| A0A0E0HRI1 | 52-109 | None |
| A0A287XFF3 | 1-54 | None |
| A0A4S4ELE6 | 80-133 | None |
| A0A5J9VYE7 | 88-142 | None |
| A0A444DEK9 | 4-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.