DPCstruct | MC14261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 262 ± 71 aa |
| Standard deviation of domain lengths | 71.28 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 76.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4M4K5 | 1-166 | DSRNVRDVAELLDVDLRDDVGVLTPRLERMYMVELEDLIDSGELTPETTAELAEICEPLHVDEETAGRLLEQTVAKRCAGGLLQAAA… |
| A0A287ERF7 | 27-281 | MGGKEVVVSVSSPVLPPASRVKEPARKVRRKEPQGRVPEWWPEMETELVELGQEAERWAILANRLVRAIIDNRVAGKDYRYDDAVQL… |
| A0A7R9T3V9 | 79-426 | None |
| K8F376 | 197-549 | None |
| M7ZAT7 | 1-264 | None |
| A0A7R9WCR0 | 100-295 | None |
| A0A4S8IER5 | 132-464 | None |
| A0A812KHL4 | 384-571 | None |
| A0A7J7IMX9 | 56-282 | None |
| A0A482SQX5 | 7-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.