DPCstruct | MC14257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Standard deviation of domain lengths | 10.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U1N2S6 | 27-97 | LIHDLALGFIRLPFNKTYYINKKPYNLPLEERYSFINGVHKLWVFSTDEPHYRGSQTKPRSELSINGYKYS |
| A0A287EKR2 | 3-101 | AASTQTTMASLATFSWISLYLLAVLLAPASAQDPTAGFTAVSLSESNFQLQKPYNMPSSARYSFDGTVRRMWVLSSDEPFSPQSDTK… |
| A0A061FHF6 | 2-86 | None |
| A0A3B6GNW4 | 1-101 | None |
| A0A453MQ26 | 27-97 | None |
| A0A4S4E4G0 | 154-227 | None |
| A0A4S4E2P8 | 90-186 | None |
| A0A453E6Z3 | 9-98 | None |
| A0A0E0BPL4 | 21-94 | None |
| A0A835JAW9 | 113-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.