DPCstruct | MC14255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 6.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 52.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287EK27 | 11-93 | FHFDAPDTHHPKVCVQTSTSAGLDQILPWLYYHKVVGVAHFLLFVEGKAAKPTVAGILESIPGMKMVYRTKELEEQQARRSET |
| A0A287EK87 | 1-78 | APTFPYLRGWSFHFDAPDTHHPKVCVQTSTSAGLDQILPWLYYHKVVGVAHFLLFVEGKAAKPTVAGILESIPGMKMV |
| C1MKA8 | 149-242 | None |
| D7LH72 | 637-723 | None |
| A0A314YRT5 | 29-103 | None |
| A0A2G9HH57 | 96-173 | None |
| A0A287EK60 | 39-121 | None |
| A0A2R6W4J8 | 49-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.