DPCstruct | MC14253
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835DZ46 | 1-75 | MQPPVDPVPAAQDVDWANLGDGPAGLIAELVLANDVADYVRFRAVCQPWRRCSPDPRVCGLDDCFLPRRWIMHDK |
| A0A287EDX7 | 59-133 | RNPPLHHHHPPDTDNCSRDWTNLGEGPAGLIAERVLANDVADYVRFRAVCGPWRRCCDDPRGHGALDRRFHPRRW |
| A0A0A9EZZ3 | 1-77 | None |
| A0A453MCT5 | 5-82 | None |
| A0A0A8Y4G9 | 145-218 | None |
| A0A453DJI1 | 1-79 | None |
| N1QZ92 | 87-162 | None |
| A0A2T7C1D2 | 1-106 | None |
| Q0D502 | 16-92 | None |
| A0A453H3H9 | 12-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.