DPCstruct | MC14252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 6.09 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 62.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6N371 | 1-102 | MAGQKKGSIAFFATYKPPVPLDIFSCPVSPTSRHEELRMTDGLSYNYNCQVIPPEALKTIIRRPILASEASEADVDSGRLSGLVFVS… |
| A0A287EBV8 | 1-116 | PRTMGESRGSISFFGTYRPPVPLGIFSCPIDPPPSSHQDELLLTDDLSYNQNGQHVPATALREILAFMARKNPKMASDCGGVTLDDV… |
| A0A453MV84 | 115-220 | None |
| A0A453MV77 | 59-164 | None |
| A0A6A6N6M6 | 73-176 | None |
| A0A6A6N218 | 211-313 | None |
| A0A7J6HQ88 | 1-115 | None |
| A0A287VC30 | 1-118 | None |
| A0A2T8I542 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.