DPCstruct | MC14250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453T758 | 2-129 | LQLIFPGADPQLLRGYFEASGNVLDAAIRGFKDYLASGSALTNADAASSGVASDVLEMNARTNSIDWAELIVREMSAASDLIDAKSR… |
| A0A287E7N4 | 25-128 | QLLRGYLEASGNVLDAAIRSFRGYLASDSATTNAGTSSSGVASDVPEMNAPTNSTEWAELIVKEILSASDMIDARDRSFRILEMFDK… |
| A0A5D2Q9Q2 | 6-135 | None |
| A0A7J9HM95 | 5-148 | None |
| A0A6A3BDL4 | 2-135 | None |
| A0A4U5PPG8 | 77-199 | None |
| A0A4S8IZJ2 | 111-273 | None |
| A0A287E7P6 | 6-133 | None |
| A0A061GP45 | 55-191 | None |
| A0A834W227 | 55-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.