DPCstruct | MC1425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 98 ± 25 aa |
| Standard deviation of domain lengths | 25.08 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 89.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6D317 | 27-114 | PGKPGFDAYGGYLNIKGEATGRFHLETINDRHFLVTPEGHGYIALGVCHTGEIARSQEYFQEHCASDLEIANGELTTQFREWGYNGLG |
| A0A496BAM4 | 2-74 | AGFYTIEKRDGRWWFITPDGAPFWSIGMNHIDSAALRYVESDGVWEREFANSHEQWLRAVASDLRDWGFNTIG |
| A0A842W3S6 | 52-155 | None |
| A0A7C3TGH5 | 59-161 | None |
| A0A6B1EUE0 | 2-76 | None |
| A0A357G5L4 | 12-164 | None |
| A0A2D5S7X2 | 23-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.