DPCstruct | MC14248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 137 ± 22 aa |
| Standard deviation of domain lengths | 22.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 67.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6QNN0 | 2-111 | SLIRQDVKNSLQPLFKHVEQGSEIREKIICFLRDKVFPLKAELLKPQAEMERFITDLIKKSVQDVTGSEFELFMGFLRSLSIFGDSA… |
| A0A287E2Q9 | 2-112 | SLIRQDVKNSLQPLFKHVESGSEIREKIICFLRDKVFPVKAELLKPQAEMERYITDLIKKSVQDVTGLEFKLFMDFLRSLSIFGDTA… |
| A0A1J6IK10 | 628-773 | None |
| A0A2R6PRQ7 | 2-117 | None |
| A0A2I0WRN9 | 27-159 | None |
| A0A6D2I1H5 | 357-516 | None |
| A0A5N5N027 | 3-151 | None |
| A0A453NVG1 | 15-196 | None |
| A0A5P1EPQ0 | 131-269 | None |
| A0A2P6SJ93 | 132-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.