DPCstruct | MC14246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 271 ± 16 aa |
| Standard deviation of domain lengths | 15.58 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5GD37 | 19-289 | KRESVFYPLAVRDRAVVNARQHGWAAAIRKKAIADAARWLRMSDDELWREMFGPHITRSHMVWSSGHCPACRRPVPMYDWQIDAWAH… |
| A0A7C6Z0Z8 | 15-320 | IKGKSTEVKNIKSVKKKRTYYTDKKVNAARTNIQMYQWAKDIMNESVENAEYYLSLGIDYLWSLVTSQGIPRSGAVCDDGCPVCGKG… |
| A0A1V5LUX6 | 15-292 | None |
| A0A842HHC8 | 1-246 | None |
| A0A356B2W8 | 1-253 | None |
| A0A5C4T441 | 1-282 | None |
| A0A7Y5W307 | 54-330 | None |
| A0A660Y790 | 26-297 | None |
| A0A1F6CWL1 | 188-446 | None |
| A0A329MTC9 | 224-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.