DPCstruct | MC14244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2INW2 | 1-63 | MIKENEFHYLSGKDKVLIYRQNEVVKTIKGSDADKFITNIADMSDIQAQIYMAKLTGNFKPGN |
| A0A7C6HNT8 | 4-71 | FSYQSTKDKVRIFWDNRPIMTLSGQKAADFLAKAEDLDEAELQLLLAKLTGQFKHGNERMAKNHRRNR |
| A0A842WUX7 | 5-74 | None |
| A0A2E9JLU6 | 20-89 | None |
| A0A0F7REH8 | 113-184 | None |
| A0A2C0VUX3 | 6-73 | None |
| A0A7K3FE88 | 37-94 | None |
| A0A7W0SFQ6 | 2-60 | None |
| A0A7V5WQM3 | 4-73 | None |
| A0A1H1L9E1 | 98-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.