DPCstruct | MC14243
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 335 ± 82 aa |
| Standard deviation of domain lengths | 81.58 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 87.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 19.54 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0023- CL0237 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H5UA90 | 17-231 | YIAHVRTTDKEKQTLAIHLQEVADITKKLASKINVAEAGELIGLLHDFGKYSTAFQNYIQSGTGLLNPDMDANYVDVIALKGKIDHS… |
| A0A7C6HMJ8 | 4-354 | FARPSIDGQEFQPLHEHIKNVAEYAALFGKRNHLSAICRLLAYLHDMGKYSLEFQRYIREIAEDIQKEKRSSPSRVDHGSYGAAYLY… |
| C8VX80 | 5-440 | None |
| A0A847H567 | 1-165 | None |
| A0A6L5YBM0 | 1-298 | None |
| R4KJP6 | 4-312 | None |
| C0BSK0 | 5-217 | None |
| X2JUW9 | 2-251 | None |
| A0A640TU15 | 19-340 | None |
| A0A1E5KX85 | 2-341 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.