DPCstruct | MC14242
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 521 ± 86 aa |
| Standard deviation of domain lengths | 86.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847GDU0 | 3-512 | YWDEWDVLFPTMQKMKAEGNKVPQFCFWSFNGPSITVVQDLYEKVYKAEKYKDLWFYWDGKPLLLYNATPSVDANGKDIKHPNPNYD… |
| A0A7C6HH72 | 147-595 | WQILLDTWAEIREEGGMTPYVVFHCGVNAPTMKSHMPTIFKAYQNPKYNDLWFRWEGKPLILGDYTMLEQKYLDFFTLRESWAFNGW… |
| A0A7V6LHZ1 | 388-968 | None |
| A0A1V5W3M6 | 12-655 | None |
| A0A661WV85 | 459-969 | None |
| A0A4P5YLG0 | 64-523 | None |
| A0A1C5T182 | 118-687 | None |
| A0A316RYU4 | 269-849 | None |
| A0A7C1H191 | 3-377 | None |
| A0A660QFJ5 | 2-402 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.