DPCstruct | MC14241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 108 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015TMB0 | 1-101 | MIRIAKETLKKKAPEYLIENGAPIISKHRVRYLTPAEEKEVPEFSTFYGAKSGQVYYIVEFPQDESIESFDAGFVAQVYIWEDTSRP… |
| A0A0A2EWI3 | 27-129 | LPKTEREKKIMEIAKEVYKRDKFKAFYREYGEPKIVERAATQDYDNPDTPSYGVRKGEILYSVYFFYDMTKERMEEDFAAKVVISDK… |
| A0A415QES7 | 14-128 | None |
| A0A1M3DPM5 | 17-123 | None |
| R6KHU5 | 489-598 | None |
| A0A3A5QMT0 | 2-99 | None |
| A0A0M2XU74 | 4-117 | None |
| A0A1M5G4B9 | 147-256 | None |
| A0A354M3R3 | 15-125 | None |
| A0A3Q9IPH0 | 20-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.