DPCstruct | MC1424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 118 ± 23 aa |
| Standard deviation of domain lengths | 22.60 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 92.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3UG55 | 113-223 | PKAELEKVIARGKVLFNDPKLGKSGSSCNSCHPNGGTTGGQMMGMAIPTLKGSAATFPKYKANAKAVITLQQMNNMCIQMIMKGTPL… |
| A0A7W1AP54 | 85-187 | ERLASFRERGKQLYRQRMGQLDLACTQCHDDSAGKRLGSSVIPQAHPTGYPIYRLEWQSLGSLQRRLRGCLTGIRAEPFAYDALELV… |
| A0A381D0W2 | 56-216 | None |
| A0A3C1TEX1 | 4-134 | None |
| A0A2V7J1Y9 | 2-119 | None |
| A0A4D7JLX3 | 54-174 | None |
| A0A0F7JRG7 | 165-272 | None |
| A0A0Q7WKL8 | 115-225 | None |
| A0A5B8SU10 | 106-220 | None |
| A0A1J4X9B5 | 82-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.