DPCstruct | MC14239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1QHX8 | 64-191 | MKMLKKGGLITAQPFDEKIEWTWFLIWHHQGRRARHGASMMQPDYTHWHGLFEVAEAFYTELIPEAREKVEAGKKAGGKKAKAARAV… |
| A0A836RJ85 | 1-115 | MAELKKQGLLTKIPFDEEIEWTWFYLWHHEGRRGRHGASMMAPDYAHWHGSYEVAERFYQELIPQAREIIEHARSEGKVAEAKAVED… |
| A0A661D7C8 | 367-507 | None |
| A0A2D6EA61 | 74-192 | None |
| A0A3M2APL9 | 258-365 | None |
| A0A1V5YI41 | 640-724 | None |
| A0A1J5I5K9 | 344-465 | None |
| A0A661NSC1 | 423-525 | None |
| A0A1E2UVC2 | 358-452 | None |
| A0A836S734 | 377-476 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.