DPCstruct | MC14238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 12 aa |
| Standard deviation of domain lengths | 11.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 34.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517ZAC2 | 37-102 | RSTTSRKKVKAAERKRVVWGIFTGTLKEEARFPYDQKEAAEEKLKQLLAKGKRSYFLQPIKEVITD |
| A0A836RAL5 | 25-106 | KKTPTKKATASATAKKKRVTKKSKKSKAANRRRLVWVIFSGAMKEEGRFPYEQRKEAEERLKQLRAKGKRMYFIQPIKEPVT |
| A0A7X7YYB9 | 1-68 | None |
| A0A4V0I5C4 | 47-140 | None |
| A0A838QXF4 | 3-85 | None |
| A0A3D3VYG5 | 23-122 | None |
| A0A7C6AZX1 | 25-96 | None |
| A0A432MHC2 | 28-119 | None |
| A0A353Z578 | 51-139 | None |
| A0A5B1CBP4 | 79-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.