DPCstruct | MC14237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 180 ± 21 aa |
| Standard deviation of domain lengths | 21.19 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.68 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | CL0023- PF06130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0F9P3 | 20-205 | KPVVCNVSNRHVHITQEDFKTLFGHSYAMRKLKDLMQPGEFASKELLEISGPRGSIKKVRILGPFRKYTQVEISRTDCFKLGIAAPV… |
| A0A836RHQ0 | 1-163 | TVYRWLYQEGYFAAEQTVAVVGSRRRMLSSVRVLGPCRGDSQVELAFTDAISLGIDAPVRISGDHRDTPGCVLVGPKGVVELQKGVI… |
| A0A2D7QPR1 | 67-262 | None |
| A0A2E7K1U1 | 220-415 | None |
| A0A330LQL4 | 480-671 | None |
| A0A0F2IYR3 | 349-535 | None |
| A0A661Q5N5 | 267-453 | None |
| A0A1E4B2G2 | 137-323 | None |
| A0A7W8IM80 | 60-248 | None |
| A0A1F5EET2 | 2-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.