DPCstruct | MC14235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 371 ± 65 aa |
| Standard deviation of domain lengths | 64.78 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8LE63 | 112-450 | AARRFSPAEQSAVVENALRVMSLTKGFARLVLLCGHGSTTENNPYASAYHCGACGGNPGGPNARVLAALANKAQVRQELRNQGIEIP… |
| A0A7Z9L8D6 | 80-487 | KRNPAGSFMLIDVLGLFFSVRLIGKTFFQRSYESIKAWARGWFTRPVATQIPIDLVDDDPGEASAALPHGFSLIEQATFVENGMRAI… |
| A0A136K6T7 | 488-924 | None |
| A0A7C3QX10 | 58-508 | None |
| A0A023DZY0 | 7-319 | None |
| A0A519UGZ0 | 286-673 | None |
| A0A1G7WNQ6 | 60-495 | None |
| A0A7V5MHM7 | 2-293 | None |
| A0A2T2X529 | 611-1029 | None |
| A0A0J9EBB0 | 800-1212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.