DPCstruct | MC14233
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 259 ± 32 aa |
| Standard deviation of domain lengths | 31.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9I888 | 1-313 | MNQGPESAMPERIKLHFAGEREDKDPIDSGFGPWALTRLCYETGGIYFAVHPNRNVNRAVSKREVVSFSAHLEHFFDPSIMRDYRPD… |
| A0A7Z9L748 | 145-412 | GPETAFVEQLQTNGFRRRYDSFSSGFGPYEQTRLARETSGVFFMLPSVETNLVRGNVDKRRYQLEALRPYLPDMRSRLEQIQERDEV… |
| A0A351FT66 | 9-278 | None |
| A0A7C7T1S3 | 201-466 | None |
| A0A7C5R953 | 277-590 | None |
| A0A517XSZ2 | 582-818 | None |
| A0A2G4FNS0 | 479-719 | None |
| A0A177R5B2 | 247-480 | None |
| A0A177QF24 | 760-963 | None |
| A0A518GSC3 | 366-622 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.