DPCstruct | MC14229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A6T1V3 | 129-207 | MDFLLLFSDAGRVVVEVDGSQHFAEDGKPSLARYADMVAADRDLRLAGYEVYRFGANELTGHGSAERIEAFFRRLLRKH |
| A0A7Y9GGM5 | 1-83 | MDFLLLLPHRARVVIECDGKQHYADFDGRTDPRRYAAMMAEDRDLRLKGYEVYRFGGADLTDDQATEQLLSAFFDRLHERHRQ |
| A0A1Y2NLG2 | 30-107 | None |
| A0A4R2JDS6 | 188-259 | None |
| A0A7X6CMI1 | 1-102 | None |
| A0A5M3WFW4 | 451-535 | None |
| A0A7H8KLJ5 | 328-408 | None |
| A0A3D0S8P4 | 223-299 | None |
| A0A5B2V5U7 | 376-462 | None |
| A0A388RT89 | 119-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.