DPCstruct | MC14228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839NBE1 | 425-528 | PAGYGPTDFRAAYHLPKSGGSGRTVAVVAAYGYPTLAKDLAAYRKASGLPACTVASGCLTIVGQNGGKPPTDVDEGWALEQAMDVQA… |
| A0A536NBR6 | 494-601 | TPCGYTPAQIRAAYGVDQTGLTGAGVRVGITDAFASPTIVADVNRFSANHGLPPLTASNFQQIVVPGTFNAPENRFDPQGWYGEQSL… |
| A0A5B9WBW8 | 59-171 | None |
| A0A2W5X6Y2 | 231-335 | None |
| A0A354GT40 | 24-156 | None |
| A0A1U7GKU5 | 39-164 | None |
| A0A7R7DSB3 | 78-188 | None |
| A0A6M5Z2J6 | 32-164 | None |
| A0A7W9KDI6 | 41-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.