DPCstruct | MC14227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 61.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02325 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1TUB4 | 22-94 | FILRIVLTWYPQVELNKLPWNLIAWPTEPFLIPTRKLIPPLGGVDITPILWVGIFSLLRELLLGQQGIITMMM |
| A0A0A9HZW9 | 1-70 | MSWYPRLPVTKFPYVLAYAPTEPFLAVTRKVIPPLGGVDVTPVVWFGLVSFLNEILVGPQGLLVLLSQQV |
| A0A2Z5X2F4 | 1-74 | None |
| A0A7J6W0U8 | 277-348 | None |
| A0A835S5I0 | 111-182 | None |
| A0A1E5UPM7 | 76-132 | None |
| A0A5B8MTV6 | 171-241 | None |
| A0A7S2KHM3 | 43-115 | None |
| A0A2P5BN48 | 137-208 | None |
| A0A7S1MTV8 | 122-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.