DPCstruct | MC14222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 12.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 91.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H1H4R0 | 184-274 | YASAIALIQRNSRFVSKDVNQALPGDLLFFDQGDDQHLMIWLDRYIAYHTGTVTPADTGLRAVAVSDLMQWKDSRWQPLDGNPNFVG… |
| A0A7V9TFJ5 | 1-94 | GRDRRQAKPGDLLFFHQPWAQAFPDHVMIFLGEAREASEDATDWVVYHTGATAGEEGTIKKVRLAVLDHHPDARWRPVAGNRNFVGF… |
| A0A7W0K5J1 | 1-115 | None |
| A0A838MXI9 | 70-197 | None |
| A0A7C2PJA0 | 1-105 | None |
| A0A660QCH0 | 233-319 | None |
| A0A7G6AAX5 | 80-170 | None |
| A0A7C3I048 | 95-205 | None |
| F4VHJ8 | 121-211 | None |
| A0A3D0H220 | 377-496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.