DPCstruct | MC14220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7MGT6 | 260-370 | EAGLIEVTYQTLPGGPAEPAGRPMTIAEVTDVLRRLPPRTGSWLSAVGRSGGCVQVAWEEGGLWLETPDVGAAASVGKHATLDEAER… |
| V7IGE1 | 3-127 | RTYQIFYSFYTDDAHIDGGSPITVSAAELPQYFRRLKQHHDFLGIIDRHDNTFQILLEEFSGFYWGEIPDPVKAGAHGRFYSAEELL… |
| A0A517SQB3 | 1-110 | None |
| A0A3N4NIS8 | 1-120 | None |
| A0A157PKK5 | 34-142 | None |
| A0A840WIE7 | 368-482 | None |
| A0A4Q7B471 | 1-120 | None |
| A0A2I8DS11 | 172-285 | None |
| A0A3A9VMS8 | 1-117 | None |
| A0A0A6XFU7 | 405-518 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.