DPCstruct | MC14217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B1AWT0 | 2-76 | QDSHIAALIHLFSREVGVSESYASRLLSGSGDTVRRLESGMSMTHRRSERLIQAASDNWPAGAPWPQSIPRPQPS |
| A0A2W4V669 | 4-84 | ITQLVTVARAYADAEKLDLTTVSWRLFGDSKKLRHLTQGRDIQVRRHEQAMRWLSSNWPCGTDWPADISRPPSEGSTVDAS |
| A0A1V0RT86 | 3-79 | None |
| A0A2N3CQ67 | 41-122 | None |
| A0A511XKU1 | 2-74 | None |
| A0A6N9BXJ7 | 1-76 | None |
| A0A543NXL7 | 4-83 | None |
| A0A368A4S1 | 6-87 | None |
| A0A257GJN5 | 1-72 | None |
| A0A1X7NFD5 | 8-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.