DPCstruct | MC14216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Standard deviation of domain lengths | 11.57 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U0SUA5 | 137-227 | MVRDFQRIIGMEARVQIQGQAGRLPDAVVACVGGGSNAIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPGAFHGSFSYL… |
| K8PI23 | 3-79 | SPGEEEQCVIGKETRLQMIEAEGRLPDSLVACIGDGSNAIGLFHPFLDEPTVEMYGVEAAGRGLKSGMHAASIVRGR |
| A0A6L5DCR6 | 295-385 | None |
| A0A812SKT9 | 52-142 | None |
| A0A447U2B0 | 131-212 | None |
| A0A378C9T9 | 49-139 | None |
| F4PSW7 | 205-272 | None |
| A0A1S8VFD5 | 496-547 | None |
| A0A1Q9CIZ3 | 53-104 | None |
| A0A829WMI3 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.