DPCstruct | MC14211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 156 |
|---|---|
| Mean domain length (aa) | 172 ± 31 aa |
| Standard deviation of domain lengths | 31.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.28 |
| Pfam Score | 97.23 |
| Assigned Pfam label(s) | PF10062- PF08486 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2JNV2 | 119-275 | INYVDLEDYVASVVDAEMGSRFFPEALKAQAVAARSYVLYHRNSRGWFDVFSDTRSQVYRGLSQRSAAALEATQATRGVVMVYGGQF… |
| A0A850ABJ0 | 96-267 | YLRDVVTQEMGPAAHHPQAVRAQAVAARTYAYWHINSGSTINNSAGFQVFLPRKYDTLTASQKSVVDAAMQDRYYMSSDTNDSPIFS… |
| A0A832C9Q8 | 247-430 | None |
| A0A7V2RX38 | 68-281 | None |
| A0A7V3HJX5 | 93-279 | None |
| A0A4Q3J0D8 | 29-227 | None |
| A0A7Z9W0L5 | 67-175 | None |
| A0A3M1GLG1 | 3-274 | None |
| A0A5C1FMB8 | 162-338 | None |
| A0A1J5ABY3 | 1-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.