DPCstruct | MC1421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 382 ± 67 aa |
| Standard deviation of domain lengths | 67.31 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K0CTK0 | 90-488 | RTDLRAAVLRLGGGRALWLARLSGEWRFALRDGAASSPGVPDLDDPPAVRARWEEGLFAERIALLTAVRRRLPAAAIALLATSWPQE… |
| A0A4V2FJ28 | 4-318 | RYATPAVKAGYISGRRAIDLDAARALVEAVWKTEDADSRFRLLGAFRERLSEADAPFLKSLEKDRAPRVRALSQRLIVKLPGFEGSD… |
| A0A2X3L2U6 | 246-715 | None |
| A0A7X0K549 | 193-611 | None |
| A0A1C3H722 | 125-495 | None |
| A0A4Z0EQK8 | 619-998 | None |
| A0A6P0TFL4 | 1-561 | None |
| A0A509ELP4 | 1-292 | None |
| A0A5R8NJL8 | 452-834 | None |
| A0A496W5Z0 | 198-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.